PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00111.1_g00041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 614aa    MW: 67415.2 Da    PI: 6.8199
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00111.1_g00041.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3764.2e-24164265199
                              EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                              f+k+lt sd++++g +++p++ ae++      ++++ s++l  +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+
  Rsa1.0_00111.1_g00041.1 164 FCKTLTASDTSTHGGFSVPRRAAEDCfppldYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVL 249
                              99****************************955566778*********************************************** PP

                              EEE-SSSEE..EEEEE-S CS
                       B3  82 Fkldgrsefelvvkvfrk 99 
                              F   + ++++l+++v+r+
  Rsa1.0_00111.1_g00041.1 250 FL--RGDDGKLRLGVRRA 265
                              **..3489999***9986 PP

2Auxin_resp1102.4e-36290371182
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                              +aha+st+++F+++YnP+ s+s+F+v+++k++k ++ ++++GmRfk ++e+ed+s rr +G+++g+sdldp+rWp+SkWr+L
  Rsa1.0_00111.1_g00041.1 290 VAHAISTNTAFNIYYNPKGSWSNFIVPAKKFLKIVDYPFCIGMRFKARVESEDASDRRSAGIITGISDLDPIRWPGSKWRCL 371
                              79*******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.83E-42153285IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-39157276IPR015300DNA-binding pseudobarrel domain
CDDcd100171.08E-21162264No hitNo description
PROSITE profilePS5086313.197164266IPR003340B3 DNA binding domain
SMARTSM010199.0E-22164266IPR003340B3 DNA binding domain
PfamPF023624.6E-22164265IPR003340B3 DNA binding domain
PfamPF065071.4E-30290371IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MGGLIDLNVT EEEDETLSSA SGSLSPSSNS SSSALFGVSG SSSSSSGVCL ELWHACAGPL  60
ISLPKRGSLV LYFPQGHLEQ QAPAAVYGLP PPPPPPPPPH VFCRILDLKL HAEIDTDEVY  120
AQVSLLPESE DIERRVREGA VDVDGGEQED YEVLKRSNTP PHMFCKTLTA SDTSTHGGFS  180
VPRRAAEDCF PPLDYSQPRP SQELLARDLH GLEWRFRHIY RGQPRRHLLT TGWSAFVNKK  240
KLVSGDAVLF LRGDDGKLRL GVRRAAHIEA ASAFSTQHNQ NMNRNNFSQV AHAISTNTAF  300
NIYYNPKGSW SNFIVPAKKF LKIVDYPFCI GMRFKARVES EDASDRRSAG IITGISDLDP  360
IRWPGSKWRC LLVRWDDNEA NRHQQRVSPW EIEPSGSVSN SGSFITTGPK RSRIGFSDIP  420
VSEGINATDF EESLRFQRVL QGQEKIPGFI NTSSDGGGAG ARRGRFKGTE FGDSYGFHKV  480
FQGQETVPSY SMTPPNQQHQ GLSQRNAWCG GPFQNFSSRV LPSSSVHVSS SPSSVLITSS  540
NGLNEGLEEH HGGGSGRCRL FGFPLRDDDE PTAMVVPCVE GQKGVSDVQS SHHHLHSQGR  600
DMYGMRDMLL DIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1104540116361Auxin response factor 1
4ldw_A1e-1104540116361Auxin response factor 1
4ldv_A1e-1104540116361Auxin response factor 1
4ldx_B1e-1104540116361Auxin response factor 1
4ldx_A1e-1104540116361Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013744526.10.0PREDICTED: auxin response factor 3-like isoform X2
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLA0A078HK540.0A0A078HK54_BRANA; Auxin response factor
STRINGAT2G33860.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49242849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein